DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Gsc and lhx6a

DIOPT Version :9

Sequence 1:	NP_001137762.2	Gene:	Gsc / 33240	FlyBaseID:	FBgn0010323	Length:	473	Species:	Drosophila melanogaster
Sequence 2:	NP_001004015.1	Gene:	lhx6a / 445565	ZFINID:	ZDB-GENE-041025-1	Length:	375	Species:	Danio rerio

Alignment Length:	141	Identity:	37/141 - (26%)
Similarity:	58/141 - (41%)	Gaps:	34/141 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   337 PKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKRE 401
            ||..:|.||.||.|||:.::|.|.:.:.||....::||....|....::|||:|.||:.:|.
Zfish   243 PKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCRARHKKH--- 304

  Fly   402 EQERLRKLQEEQCGSTTNGTTNSSSGTTSSTGNGSLTVKCPGSDHYS-------AQLVHIKSDPN 459
                                |...:|...:.....:....|...|||       |::|.:    :
Zfish   305 --------------------TPQHNGPPQAHPQARMPPSLPDELHYSPFGSPERARMVAL----H 345

  Fly   460 GYSDADESSDL 470
            ||.|:...|.|
Zfish   346 GYIDSHPFSVL 356

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Gsc	NP_001137762.2	Homeobox	343..396	CDD:278475	20/52 (38%)
lhx6a	NP_001004015.1	LIM1_Lhx6	97..150	CDD:188766
		LIM2_Lhx6	158..212	CDD:188768
		Homeobox	250..302	CDD:278475	20/51 (39%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R6207
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.030