DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and sv

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_524633.3 Gene:sv / 43825 FlyBaseID:FBgn0005561 Length:844 Species:Drosophila melanogaster


Alignment Length:296 Identity:55/296 - (18%)
Similarity:91/296 - (30%) Gaps:101/296 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GGGGGTTTTTPSTTPDIPPSKAKFKITVVSTPSPSPPPTPPPAGSMLAQMVETN---SPPAGYTL 71
            |||...|.:..|:|..|                  ..|.||.:.|. |..|.||   |.....::
  Fly   322 GGGHIATESVDSSTGTI------------------GEPQPPTSNSS-ANSVNTNVSASASVHASI 367

  Fly    72 KRSPSDLGEQQQPPRQISRSPGNTAAYHLTTAMLLNSQQCGYLGQRLQSVLQQQHAQHQQSQSQT 136
            ..|.:|         .:..|.|:..|....|..:.::.:....|..:..:|..||..|..:.:..
  Fly   368 PTSGTD---------SVQVSVGHINANSNETTHINSTAEQRTTGYSINGILGIQHGHHSHNNNNN 423

  Fly   137 PS------------------------------SDDGSQ----------------SGVTILEEERR 155
            .|                              :|||.:                ||...::::.:
  Fly   424 SSVNNNNNTESSCKRKRIEAHDENHDTNIHSDNDDGKRQRMSTYSGDQLYTNIWSGKWCIKDDHK 488

  Fly   156 ----GGAAAASLFTIDSILGSRQQGGGTAPSQGSHISSNGNQNGLTSNGI--------------- 201
                .|...||.....:.......|..|.|..||..:::||...:..:.|               
  Fly   489 LLAELGNLTASTGNCPATYYEASNGFSTTPISGSGATASGNDTSMLYDSITTISQTQSSIYTPAI 553

  Fly   202 --SLGLKRSGAESPASPNSNSSSSAAASPIRPQRVP 235
              |:|   :|:.:|..|.|......:|:.|:.|.||
  Fly   554 GPSIG---TGSLTPLVPISMHEMKLSANSIQEQTVP 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475
svNP_524633.3 PAX 175..299 CDD:128645
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451034
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.