powered by:
Protein Alignment Gsc and LHX8
DIOPT Version :9
Sequence 1: | NP_001137762.2 |
Gene: | Gsc / 33240 |
FlyBaseID: | FBgn0010323 |
Length: | 473 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016856805.1 |
Gene: | LHX8 / 431707 |
HGNCID: | 28838 |
Length: | 363 |
Species: | Homo sapiens |
Alignment Length: | 61 |
Identity: | 23/61 - (37%) |
Similarity: | 38/61 - (62%) |
Gaps: | 0/61 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 337 PKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRK 397
||..:|.||.||.:||:.::|.|.:.:.||....::||.:..|....::|||:|.||:.:|
Human 212 PKPAKRARTSFTADQLQVMQAQFAQDNNPDAQTLQKLAERTGLSRRVIQVWFQNCRARHKK 272
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Gsc | NP_001137762.2 |
Homeobox |
343..396 |
CDD:278475 |
19/52 (37%) |
LHX8 | XP_016856805.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R6207 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.