DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and Poxm

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001036687.1 Gene:Poxm / 40990 FlyBaseID:FBgn0003129 Length:370 Species:Drosophila melanogaster


Alignment Length:307 Identity:73/307 - (23%)
Similarity:102/307 - (33%) Gaps:118/307 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 AQHQQSQSQTPSSDDGSQSGVT-------ILEEERRGGAAAA-------------------SLFT 165
            |::.::.|..|.:..||:..||       |.|.::|.....|                   |:.:
  Fly    63 ARYHETGSILPGAIGGSKPRVTTPKVVNYIRELKQRDPGIFAWEIRDRLLSEGICDKTNVPSVSS 127

  Fly   166 IDSILGSR------QQGGGT-----APSQGSHISSNGNQNGLT--SNGI---SLGLKRSGAESPA 214
            |..||.::      |...||     :.|.|..:||||.||..|  ||.|   :||....|...|.
  Fly   128 ISRILRNKLGSLGHQHTPGTVMGSGSSSGGGSVSSNGGQNNGTSASNNINLSNLGNPGGGPHHPH 192

  Fly   215 SPNSNSSSSAAA------------------------------------SPIRPQ------RVPAM 237
            ..:.:.|::|||                                    ||..||      .||  
  Fly   193 HHHHHQSAAAAASAHHVHAHAHAHAHLYNSIYQPYSAAAAYSMKTPCGSPSPPQGAGGQGSVP-- 255

  Fly   238 LQHPGLHLGHLAAAAASGF---AASPSDFLVAY----------------------PNFYPNYMHA 277
              ||. .|..:|||||:..   :.|.||.|..:                      ....|..|..
  Fly   256 --HPH-QLRSVAAAAAAAHWPSSHSVSDILAHHQAVALRASCQVGVGVGGMGGMGSTVSPLPMTP 317

  Fly   278 AAVAHVAAAQMQAHVSGAAAGLSGHGHHPHHPHGHPHHPHLGAHHHG 324
            :.||..|..|......|.|...|.:.::.:..:|..|| |   ||||
  Fly   318 SPVAGTAGGQPLLDCEGGAGQQSPYNYYMYFQNGGMHH-H---HHHG 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475
PoxmNP_001036687.1 PAX 10..133 CDD:128645 14/69 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450889
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.