DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and gsb-n

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster


Alignment Length:159 Identity:59/159 - (37%)
Similarity:69/159 - (43%) Gaps:34/159 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 GPPPKRK-RRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRK 397
            |.|.||| ||.||.||.||||.||..|.:|.||||..||:||....|.|.|::|||.||||:.||
  Fly   175 GIPLKRKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRK 239

  Fly   398 QKREEQERLRKLQEEQCGSTTNGTTNSSSGTTSSTGNGSLTV-------KCPG------------ 443
            ........|..:..   ||:..|.....||.|:..|.|.|.|       ..||            
  Fly   240 HSGGSNSGLSPMNS---GSSNVGVGVGLSGATAPLGYGPLGVGSMAGYSPAPGTTATGAGMNDGV 301

  Fly   444 -------SDHYS----AQLVHIKSDPNGY 461
                   |.|:|    |...|..:...||
  Fly   302 HHAAHAPSSHHSAATAAAAAHHHTQMGGY 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 30/52 (58%)
gsb-nNP_523862.1 PAX 20..141 CDD:278709
Homeobox 185..238 CDD:278475 30/52 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450995
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.