DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and CG9876

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster


Alignment Length:329 Identity:74/329 - (22%)
Similarity:105/329 - (31%) Gaps:149/329 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LGEQQQPPRQISRSPGNTAAYHLTTAMLLNSQQCGYLGQRLQSVLQQQHAQHQ-QSQSQTPSSDD 141
            |..|||.......:|||.                 |.|..:...:...|..|. :|:.:.   :|
  Fly     2 LNYQQQLHSLPVGNPGNF-----------------YYGPTVSGEIYSSHQSHNLESEDKL---ED 46

  Fly   142 GSQSGVTILEEERRGGAAAASLFTIDSILGSRQQGGGTAPSQGSHISSNGNQNGLTSNGISLGLK 206
            ..:||..:.:..|         |::|:|:..:..    |.|:|.....      |:||....|..
  Fly    47 REESGRNLDKIHR---------FSVDNIMEMKHD----AYSKGKMAME------LSSNFGPTGAG 92

  Fly   207 RSGAESPASPNSNSSSSAAASPIRPQRVPAMLQHPGLHLGHLAAAAASGFAASPSDFLVAYPNFY 271
            ..||:.||..:.|              :||                                   
  Fly    93 CGGADRPAPCSGN--------------LPA----------------------------------- 108

  Fly   272 PNYMHAAAVAHVAAAQMQAHVSGAAAGLSGHGHHPHHPHGHPHHPHLGAHHHGQHHLSHLGHGPP 336
                                         |.|||...|                           
  Fly   109 -----------------------------GGGHHSRKP--------------------------- 117

  Fly   337 PKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKRE 401
                ||:||.|:..||..||..|::|||||..:||:||.||.|.|.||:|||:|||||:|:.:|.
  Fly   118 ----RRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRNERS 178

  Fly   402 EQER 405
            ...|
  Fly   179 VGSR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 31/52 (60%)
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450906
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.