DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and otp

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster


Alignment Length:211 Identity:64/211 - (30%)
Similarity:97/211 - (45%) Gaps:52/211 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 VAAAQMQAHVSGAAA----------GLSGHGHHPHHPHGHPHHPHLGAHHHGQHHLSHLGHGPPP 337
            |.....:.|:||...          |.||:|      :|:.::.:...::..|....||    ..
  Fly    59 VGGGVARLHISGGLCDNSNALNGGNGSSGNG------NGNNNNGNGNNNNSMQQQDQHL----DK 113

  Fly   338 KRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKREE 402
            .:::||||.||..||.:||..|.||||||:.:||::|:::.|.|.||:|||:||||||:|:|:  
  Fly   114 NKQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRKK-- 176

  Fly   403 QERLRKLQEEQCGSTTN-----GTTNSSSG--------TTSSTGNGSLTVKCPGSDHYSAQLVHI 454
                          |||     |....|.|        |..:.|:|.......|.|.:|   |.:
  Fly   177 --------------TTNVFRTPGALLPSHGLPPFGANITNIAMGDGLCGTGMFGGDRWS---VGV 224

  Fly   455 KSDPNGYSDADESSDL 470
            .....|:...::||.|
  Fly   225 NPMTAGFGQLNQSSPL 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 31/52 (60%)
otpNP_001286654.1 Homeobox 119..167 CDD:278475 26/47 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450951
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.