DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and Gsc2

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001102316.1 Gene:Gsc2 / 363831 RGDID:1305333 Length:214 Species:Rattus norvegicus


Alignment Length:290 Identity:89/290 - (30%)
Similarity:110/290 - (37%) Gaps:105/290 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 ILEEERRGGAAAASLFTIDSILGSRQQGGGTAPSQGSHISSNGNQNGLTSNGISLGLKRS----- 208
            :|.....|.|.|.|       ..|.:..|...|....||.|            ||..:|.     
  Rat     6 LLRRPPAGMATAGS-------AASHRDPGRPCPFSIEHILS------------SLPERRPVARPP 51

  Fly   209 ---GAESPASPNSNSSSSAAA--------SP-IRPQRVPAMLQHPGLHLG---HLAAAAASGFAA 258
               |..:||.|:...:.:.||        :| ..|:..|.....|||.||   .||..:.|...|
  Rat    52 QPVGGRNPAEPDEPEAPAPAAPCACCCCCNPRAAPRGTPETASGPGLRLGWPLRLAPESPSPLTA 116

  Fly   259 SPSDFLVAYPNFYPNYMHAAAVAHVAAAQMQAHVSGAAAGLSGHGHHPHHPHGHPHHPHLGAHHH 323
            ..:.                              |.|..|.||.|                    
  Rat   117 PSTG------------------------------SPALTGTSGPG-------------------- 131

  Fly   324 GQHHLSHLGHGPPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWF 388
                        |.:|.|||||||:||||:.|||.|.:..||||..||:||:::.|:||||||||
  Rat   132 ------------PQRRTRRHRTIFSEEQLQALEALFVQNQYPDVGTRERLAVRIRLREERVEVWF 184

  Fly   389 KNRRAKWRKQKREEQERL----RKLQEEQC 414
            ||||||||.|||....||    ||..:|.|
  Rat   185 KNRRAKWRHQKRVSSSRLAPGSRKPHKESC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 36/52 (69%)
Gsc2NP_001102316.1 Homeobox 139..193 CDD:395001 37/53 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7508
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm45360
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.