DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and HOXB8

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_076921.1 Gene:HOXB8 / 3218 HGNCID:5119 Length:243 Species:Homo sapiens


Alignment Length:274 Identity:64/274 - (23%)
Similarity:97/274 - (35%) Gaps:70/274 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 SLFTIDSILGSRQQGGGTAPSQGSHISSNGNQNGLTSNGISLGLKRSGAESPASPNS-------- 218
            |.:.::|:....:.|....|        |....|...:   ||.:.:....|:|..|        
Human     2 SSYFVNSLFSKYKTGESLRP--------NYYDCGFAQD---LGGRPTVVYGPSSGGSFQHPSQIQ 55

  Fly   219 ---NSSSSAAASPIRPQRVPAMLQH--PGLHLGHLAAAAASGFAASPSDFLVAYPNFYPNYMHAA 278
               :..||.:.:|.: |...|:..|  ||...|:......|.|.|...| ||.|           
Human    56 EFYHGPSSLSTAPYQ-QNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPD-LVQY----------- 107

  Fly   279 AVAHVAAAQMQAHVSGAAAGLSGHGHHPHHPHGHP-HHPHLGAHHHGQHHLSHLGHGPPPKRKRR 342
            |...:|||      ||......|....|......| ..|...|                  .:||
Human   108 ADCKLAAA------SGLGEEAEGSEQSPSPTQLFPWMRPQAAA------------------GRRR 148

  Fly   343 HRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKRE------ 401
            .|..::..|..:||..|....|.....|.:::..:.|.|.:|::||:|||.||:|:..:      
Human   149 GRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSS 213

  Fly   402 --EQERLRKLQEEQ 413
              |||.|.|.:.|:
Human   214 KCEQEELEKQKLER 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 16/52 (31%)
HOXB8NP_076921.1 Antp-type hexapeptide 134..139 1/4 (25%)
Homeobox 150..203 CDD:395001 17/52 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..243 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.