DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and CG11294

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001259352.1 Gene:CG11294 / 31807 FlyBaseID:FBgn0030058 Length:261 Species:Drosophila melanogaster


Alignment Length:168 Identity:65/168 - (38%)
Similarity:87/168 - (51%) Gaps:45/168 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 KRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKREE 402
            :|:||:||.||.:||::|||.|.|||||||.|||::||::.|.|.||:|||:||||||||     
  Fly    22 RRQRRNRTTFTPQQLQELEALFQKTHYPDVFLREEVALRISLSEARVQVWFQNRRAKWRK----- 81

  Fly   403 QERLRKLQEE---QC---------------GSTTNGTT---------NSSSGTTSS----TGN-- 434
            |.||:.||:.   :|               |.:.||.|         |.||.:..|    .||  
  Fly    82 QARLQLLQDAWRMRCLSLGTPPVMGGGAVQGGSGNGATARPPSQTPENLSSASKDSELAEVGNGP 146

  Fly   435 --GSLTVKCPGSDHYSAQLVHIKSDPNGYSDADESSDL 470
              ||.|:.     |.:.|..|.:....|:..|.:...|
  Fly   147 NSGSFTMM-----HPAFQQQHQQQQHQGHQQATDQDKL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 34/52 (65%)
CG11294NP_001259352.1 Homeobox 29..80 CDD:278475 33/50 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451014
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.