DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and Vsx2

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001284897.1 Gene:Vsx2 / 31469 FlyBaseID:FBgn0263512 Length:645 Species:Drosophila melanogaster


Alignment Length:311 Identity:99/311 - (31%)
Similarity:129/311 - (41%) Gaps:97/311 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 SLFTIDSILGSRQQGGGTAPSQGSHISSNGNQNGLTSNGISLGLKRSGAESPASPNSN-----SS 221
            |.|.|..:||........||:..:           |:.|.::..:|.....|.:.|:.     :|
  Fly     5 SPFAIQELLGLAVAAATEAPTDLT-----------TTAGATVAKERQTPTPPKTTNATMATAATS 58

  Fly   222 SSAAASPI-----------RPQRVPAMLQHPGLHLGH------------LAAAAASGFAASPSDF 263
            ::.||:|.           .||:.|...|....|  |            :..||||..|...:..
  Fly    59 AATAATPTNAAEGNLTSVSEPQQQPQQQQQEQQH--HQPHHHQYREHHQMTMAAASRMAYFNAHA 121

  Fly   264 LVAYPNFYPNYMHAAAVAHVAAAQMQAHVSGAAAGLSGHGHHPHHPHG--------------HPH 314
            .|| ..|.|:.: ||||.|....|.|.|..          ||||||||              |||
  Fly   122 AVA-AAFMPHQL-AAAVHHHHQHQHQHHPH----------HHPHHPHGAVGGPPPPPPMQHHHPH 174

  Fly   315 HPH--------------------------LGAHHHGQHHLSHLGHGP---PPKRKRRH-RTIFTE 349
            |||                          |.....|...|:..|.||   ..|:|||| |||||.
  Fly   175 HPHHPLLHAQGFPQLKSFAAGAGTCLPGSLAPKDFGMESLNGFGVGPNSKKKKKKRRHSRTIFTS 239

  Fly   350 EQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKR 400
            .|||:||..|.:.|||||..||.|:||.:|.|:|::|||:||||||||.::
  Fly   240 YQLEKLEEAFKEAHYPDVYAREMLSLKTELPEDRIQVWFQNRRAKWRKTEK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 33/53 (62%)
Vsx2NP_001284897.1 Homeobox 233..286 CDD:278475 32/52 (62%)
OAR 556..570 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450971
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.