DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and arxa

DIOPT Version :10

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_571459.1 Gene:arxa / 30657 ZFINID:ZDB-GENE-990415-15 Length:453 Species:Danio rerio


Alignment Length:63 Identity:39/63 - (61%)
Similarity:53/63 - (84%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 KRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKR 400
            :::||:||.||..|||:||..|.|||||||..||:||:::||.|.||:|||:||||||||:::
Zfish   213 RKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeodomain 341..397 CDD:459649 37/55 (67%)
arxaNP_571459.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..149
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..212
Homeodomain 216..272 CDD:459649 37/55 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 390..418
OAR 417..435 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 421..434
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.