DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and pax6a

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_009296153.1 Gene:pax6a / 30567 ZFINID:ZDB-GENE-990415-200 Length:459 Species:Danio rerio


Alignment Length:94 Identity:49/94 - (52%)
Similarity:67/94 - (71%) Gaps:7/94 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 KRK-RRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKRE 401
            ||| :|:||.||:||:|.||..|::||||||..||:||.|:||.|.|::|||.|||||||:    
Zfish   248 KRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRR---- 308

  Fly   402 EQERLRKLQEEQCGSTTNGTTNSSSGTTS 430
             :|:||. |..|..::::....|||.:||
Zfish   309 -EEKLRN-QRRQASNSSSHIPISSSFSTS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 33/52 (63%)
pax6aXP_009296153.1 PAX 31..169 CDD:128645
Homeobox 255..307 CDD:306543 33/51 (65%)
Retinal 341..>459 CDD:330657
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.