DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and pax6a

DIOPT Version :10

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_009296153.1 Gene:pax6a / 30567 ZFINID:ZDB-GENE-990415-200 Length:459 Species:Danio rerio


Alignment Length:94 Identity:49/94 - (52%)
Similarity:67/94 - (71%) Gaps:7/94 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 KRK-RRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKRE 401
            ||| :|:||.||:||:|.||..|::||||||..||:||.|:||.|.|::|||.|||||||:    
Zfish   248 KRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRR---- 308

  Fly   402 EQERLRKLQEEQCGSTTNGTTNSSSGTTS 430
             :|:||. |..|..::::....|||.:||
Zfish   309 -EEKLRN-QRRQASNSSSHIPISSSFSTS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeodomain 341..397 CDD:459649 35/55 (64%)
pax6aXP_009296153.1 PAX 31..169 CDD:128645
Homeodomain 253..308 CDD:459649 35/54 (65%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.