DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and pax3a

DIOPT Version :10

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_571352.1 Gene:pax3a / 30532 ZFINID:ZDB-GENE-980526-52 Length:509 Species:Danio rerio


Alignment Length:71 Identity:43/71 - (60%)
Similarity:51/71 - (71%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 GPPPKRK-RRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRK 397
            |.|.||| ||.||.||.||||:||..|::|||||:..||:||.:..|.|.||:|||.||||:|||
Zfish   213 GLPLKRKQRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRK 277

  Fly   398 QKREEQ 403
            |....|
Zfish   278 QAGANQ 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeodomain 341..397 CDD:459649 34/55 (62%)
pax3aNP_571352.1 PAX 34..159 CDD:128645
Homeodomain 221..277 CDD:459649 34/55 (62%)
Pax7 350..394 CDD:403540
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.