DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and hoxb8a

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_005171620.1 Gene:hoxb8a / 30343 ZFINID:ZDB-GENE-990415-108 Length:246 Species:Danio rerio


Alignment Length:232 Identity:52/232 - (22%)
Similarity:85/232 - (36%) Gaps:74/232 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 NSSSSAAASPIRPQRVP-AMLQH--PGLHLGHLAAAAASGFAASPSDFLVAYPNFYPNYMHAAAV 280
            :.:|:.:|:|.  |:.| |:..|  ||...|:.|....:.|.|..:| ||.|             
Zfish    60 HGASTLSAAPY--QQSPCAVTCHGEPGNFYGYDALQRQTLFGAQDAD-LVQY------------- 108

  Fly   281 AHVAAAQMQAHVSGAAAGLSGHGHHPHHPHGHPH--------HPHLGAHHHGQHHLSHLGHGPPP 337
                        |.......|.|....:....|.        .|.:.|                 
Zfish   109 ------------SDCKLATGGIGDETDNTEQSPSPTQLFPWMRPQVAA----------------- 144

  Fly   338 KRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQ---- 398
             .:||.|..::..|..:||..|....|.....|.:::..:.|.|.:|::||:|||.||:|:    
Zfish   145 -GRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKD 208

  Fly   399 ----KREEQERLRKLQEEQCGSTTNGTTNSSSGTTSS 431
                .:.|||::.|.:.|:         ..:|||.|:
Zfish   209 KFPSSKSEQEQIEKEKREK---------EQASGTQSA 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 16/52 (31%)
hoxb8aXP_005171620.1 Homeobox 150..202 CDD:278475 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.