DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and gsc

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_571092.1 Gene:gsc / 30212 ZFINID:ZDB-GENE-980528-2060 Length:240 Species:Danio rerio


Alignment Length:296 Identity:92/296 - (31%)
Similarity:120/296 - (40%) Gaps:98/296 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 ASLFTIDSILGSRQQGGGT------APSQGSHISSN-----GNQNGLTSNGISLGLKRSGAESPA 214
            |.:|:|||||..|.....:      ||...|:::.:     |:.|||.|:           ..|.
Zfish     3 AGMFSIDSILAGRPSCKDSVLLHRNAPVVFSNLTESLYTAAGDFNGLYSH-----------TGPP 56

  Fly   215 SPNSNSSSSAAASPIRPQRVPAMLQHPGLHLGHLAAAAASGFAASPSDFLVAYPNFYPNYMHAAA 279
            :||..|.:..                                        :.|.|:|...:|...
Zfish    57 APNLQSVNGR----------------------------------------IGYNNYYYGQLHVQG 81

  Fly   280 VAHVAAAQMQAHVSGAAAGLSGHGHHPHHPHGH-----------PH----HPHLGAHHHGQHHLS 329
            ....|..       ||...| |....|..|.|:           ||    :.::|.....:..|.
Zfish    82 PTGPACC-------GAIPTL-GSQQCPCIPTGYDSAGSVLISPVPHQMMSYMNVGTLSRTELQLL 138

  Fly   330 HLGHGPPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAK 394
            :..|   .:||||||||||:||||.||..|.:|.||||..|||||.||.|:||:|||||||||||
Zfish   139 NQLH---CRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAK 200

  Fly   395 WRKQKREEQERLRKLQEEQCGSTTNGTTNSSSGTTS 430
            ||:|||...|.....|:          .|.|:.|||
Zfish   201 WRRQKRSSSEESENSQK----------WNKSTKTTS 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 39/52 (75%)
gscNP_571092.1 Homeobox 149..202 CDD:278475 39/52 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 199..240 14/38 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7704
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - oto40947
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.