DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and Pax6

DIOPT Version :10

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_006234695.1 Gene:Pax6 / 25509 RGDID:3258 Length:436 Species:Rattus norvegicus


Alignment Length:94 Identity:50/94 - (53%)
Similarity:66/94 - (70%) Gaps:7/94 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 KRK-RRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKRE 401
            ||| :|:||.||:||:|.||..|::||||||..||:||.|:||.|.|::|||.|||||||:    
  Rat   221 KRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRR---- 281

  Fly   402 EQERLRKLQEEQCGSTTNGTTNSSSGTTS 430
             :|:||. |..|..:|.:....|||.:||
  Rat   282 -EEKLRN-QRRQASNTPSHIPISSSFSTS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeodomain 341..397 CDD:459649 35/55 (64%)
Pax6XP_006234695.1 PAX 4..142 CDD:128645
Homeodomain 226..281 CDD:459649 35/54 (65%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.