DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and phx1

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_593776.1 Gene:phx1 / 2542405 PomBaseID:SPAC32A11.03c Length:942 Species:Schizosaccharomyces pombe


Alignment Length:303 Identity:66/303 - (21%)
Similarity:108/303 - (35%) Gaps:99/303 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 DDGSQSGVTILEEERRGGAAAASL----FTIDSILG----------------SRQQGGGTAPSQG 184
            ::|.|....|...|:|......:|    :.:||.||                ...||....|:..
pombe     8 ENGGQINDNINYSEKRPTMLPENLSLSNYDMDSFLGQFPSDNNMQLPHSTYEQHLQGEQQNPTNP 72

  Fly   185 SHISSNGNQNGLTSNGISLGLKR--------SGAESPASPNSNSSSSAAASPIRPQRVPAMLQHP 241
            ::.....::|       .:..|:        |.|::.:..|.|||.....||::|..|       
pombe    73 NYFPPEFDEN-------KVDWKQEKPKPDAPSFADNNSFDNVNSSKLTNPSPVQPNIV------- 123

  Fly   242 GLHLGHLAAAAASGFAASPSDFLVAYPNFYPNYMHAAAVAHVAAAQMQAHVSGAAAGLSGHGHHP 306
                     .:.|..|.|..:.:|            .|.:...|.:..||.||.           
pombe   124 ---------KSESEPANSKQNEVV------------EATSVEKAKENVAHESGT----------- 156

  Fly   307 HHPHGHPHHPHLGAHHHGQHHLSHLGHGPPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLRE 371
                     |..|            |....||.|::.   .|.:||..|...|.|...|...:||
pombe   157 ---------PESG------------GSTSAPKSKKQR---LTADQLAYLLREFSKDTNPPPAIRE 197

  Fly   372 QLALKVDLKEERVEVWFKNRRAKWRK-QKREEQERLRKLQEEQ 413
            ::..::::.|..|.:||:|||||.:. .:|:|:||.|.|:|::
pombe   198 KIGRELNIPERSVTIWFQNRRAKSKLISRRQEEERQRILREQR 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 18/52 (35%)
phx1NP_593776.1 COG5576 116..272 CDD:227863 45/188 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.