DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and pxl1

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_596112.1 Gene:pxl1 / 2540856 PomBaseID:SPBC4F6.12 Length:438 Species:Schizosaccharomyces pombe


Alignment Length:278 Identity:59/278 - (21%)
Similarity:90/278 - (32%) Gaps:99/278 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VSTPSPSPPPTPPPAGSMLAQMVETNSPPAGYTLKRSPS--------DLGEQQQPPRQISRSPGN 94
            ::||.|.|....|            .||.:    ||:|:        ||     |..::|||  |
pombe    53 IATPLPQPSLKTP------------ESPLS----KRNPTIKQNRVRFDL-----PDDELSRS--N 94

  Fly    95 TAAYHLTTAMLLNSQQCGYLGQRLQSVLQQQHAQHQQSQSQTPSSDDGSQSGVTILE-------- 151
            .::...|   ||.|..........:.:|.:..:.......:.|||.:...|.|...:        
pombe    95 VSSPEKT---LLTSASTSTFDSLKKELLPELPSLAYSDDDEFPSSPEELNSHVNYPDVRNVYDCH 156

  Fly   152 ------------EERRGGAAAASLFTI----DSILGSRQ---QGGGTAPSQG--------SHISS 189
                        |:|:...|:..|.|:    .|.|.:|:   ....:||:..        |.:.|
pombe   157 TGLQPLVDHDCIEDRQKTFASKQLPTLPLQKSSKLSNRRPALHSFHSAPANSLYPLPTPTSQLPS 221

  Fly   190 NGNQNGLTSNGI--SLGLKRSGAESPASP-------NSNSSSSAAASPIRPQRVPAMLQHPGLHL 245
            |     |:||.:  |..||.|...|..|.       ||..|..:....:|..|:           
pombe   222 N-----LSSNNLFQSDSLKPSMVSSHTSTKPVLYRGNSEKSCHSCGGSLRAGRI----------- 270

  Fly   246 GHLAAAAASGFAASPSDF 263
                 .:|||....|..|
pombe   271 -----ISASGKKLHPQCF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475
pxl1NP_596112.1 LIM 258..314 CDD:278823 7/42 (17%)
LIM 318..370 CDD:259829
LIM 378..428 CDD:259829
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.