DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and Alx1

DIOPT Version :10

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001408403.1 Gene:Alx1 / 216285 MGIID:104621 Length:377 Species:Mus musculus


Alignment Length:114 Identity:52/114 - (45%)
Similarity:65/114 - (57%) Gaps:24/114 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 GHPHHPHLGAHHHGQHHLSHLGHGP----PPK-----------------RKRRHRTIFTEEQLEQ 354
            |.|.|..|   :....:.::|...|    |.|                 :||||||.||..|||:
Mouse    85 GQPLHTEL---NRAMDNCNNLRMSPVKGMPEKSELDELGDKCDSNVSSSKKRRHRTTFTSLQLEE 146

  Fly   355 LEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKREEQ 403
            ||..|.|||||||.:||||||:.:|.|.||:|||:||||||||::|..|
Mouse   147 LEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQ 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeodomain 341..397 CDD:459649 39/55 (71%)
Alx1NP_001408403.1 Homeodomain 133..189 CDD:459649 39/55 (71%)
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 192..326 2/4 (50%)
OAR 302..320 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.