DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Gsc and Shox2

DIOPT Version :9

Sequence 1:	NP_001137762.2	Gene:	Gsc / 33240	FlyBaseID:	FBgn0010323	Length:	473	Species:	Drosophila melanogaster
Sequence 2:	NP_038693.1	Gene:	Shox2 / 20429	MGIID:	1201673	Length:	331	Species:	Mus musculus

Alignment Length:	132	Identity:	50/132 - (37%)
Similarity:	65/132 - (49%)	Gaps:	35/132 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly   294 GAAAGLSGHGHHP------------HHPHGHPH----HPHL--------GAHHHGQHHLSHLGHG 334
            |.|.|.:|.|..|            ..| |.|.    .|.|        |....||..:
Mouse    81 GGAGGGAGGGRSPVRELDMGAAERSREP-GSPRLTEVSPELKDRKDDAKGMEDEGQTKI------ 138

  Fly   335 PPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQK 399
                ::||.||.||.|||.:||..||:|||||..:||:|:.::.|.|.||:|||:|||||.|||:
Mouse   139 ----KQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQE 199

  Fly   400 RE 401
            .:
Mouse   200 NQ 201

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Gsc	NP_001137762.2	Homeobox	343..396	CDD:278475	31/52 (60%)
Shox2	NP_038693.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..20
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	26..140		14/69 (20%)
		Homeobox	143..197	CDD:395001	31/53 (58%)
		OAR	311..327	CDD:397759
		OAR. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00138	313..326
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000011
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R6207
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.940