DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and Pitx3

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_006526827.1 Gene:Pitx3 / 18742 MGIID:1100498 Length:388 Species:Mus musculus


Alignment Length:217 Identity:72/217 - (33%)
Similarity:91/217 - (41%) Gaps:57/217 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 ISLGLKRSGAESPAS---PNSNSSSSAAASPIRPQRVPAMLQHPGLHLGHLAAAAASGFAASPSD 262
            :|||.....:....|   |.....|:.....|:.||.|:|      ..|.|..|.|...|.|.||
Mouse    48 LSLGAHSLNSACHCSGCYPLPGPPSTEIEDEIKRQRPPSM------EFGLLGEAEARSPALSLSD 106

  Fly   263 FLVAYPNFYPNYMHAAAVAHVAAAQMQAHVSGAAAGLSGHGHHPHHPHGHPHHPHLGAHHHGQHH 327
                                              ||.      ||.|  .|.|...|..|.....
Mouse   107 ----------------------------------AGT------PHPP--LPEHGCKGQEHSDSEK 129

  Fly   328 LS-HLGHGPP-----PKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEV 386
            .| .|..|.|     .|::||.||.||.:||::|||||.:..|||:..||::|:..:|.|.||.|
Mouse   130 ASASLPGGSPEDGSLKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRV 194

  Fly   387 WFKNRRAKWRKQKREEQERLRK 408
            |||||||||||::|.:|..|.|
Mouse   195 WFKNRRAKWRKRERSQQAELCK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 30/52 (58%)
Pitx3XP_006526827.1 Homeobox 152..205 CDD:365835 31/52 (60%)
PTZ00395 <228..>322 CDD:185594
OAR 344..361 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.