DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and Pitx1

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_035227.1 Gene:Pitx1 / 18740 MGIID:107374 Length:315 Species:Mus musculus


Alignment Length:237 Identity:68/237 - (28%)
Similarity:91/237 - (38%) Gaps:75/237 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 IRPQRVPAMLQHPGLHLGHLAAAAASGFAASPSDFLVAYPNFYPNYMHAAAVAHVAAAQMQAHVS 293
            :||...|.....|..||..         ||.|.:.|       .|....::.|.:...:......
Mouse    17 LRPPPPPPHDMGPSFHLAR---------AADPREPL-------ENSASESSDADLPDKERGGEAK 65

  Fly   294 G---AAAGLSGHGHHPHHPHGHPHHPHLGAHHHGQHHLSHLGHGPPPKRKRRHRTIFTEEQLEQL 355
            |   ..||.:|.|.....|                         ...|::||.||.||.:||::|
Mouse    66 GPEDGGAGSAGCGGGAEDP-------------------------AKKKKQRRQRTHFTSQQLQEL 105

  Fly   356 EATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKREEQERLRKLQEEQCGSTTNG 420
            ||||.:..|||:.:||::|:..:|.|.||.||||||||||||::|.:|..|.|          .|
Mouse   106 EATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCK----------GG 160

  Fly   421 TTNSSSGTTSSTGNGSLTVKCPGSDHYSAQLVHIKSDPNGYS 462
            .....||...           |..|.|:|          |||
Mouse   161 YVPQFSGLVQ-----------PYEDVYAA----------GYS 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 30/52 (58%)
Pitx1NP_035227.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104 27/127 (21%)
Homeobox 94..147 CDD:365835 31/52 (60%)
Interaction with PIT-1 151..280 13/62 (21%)
Forkhead_N 196..>275 CDD:369872
OAR 277..294 CDD:367680
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 281..294
Nuclear localization signal. /evidence=ECO:0000255 287..291
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.