DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and Pax3

DIOPT Version :10

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001152992.1 Gene:Pax3 / 18505 MGIID:97487 Length:484 Species:Mus musculus


Alignment Length:148 Identity:58/148 - (39%)
Similarity:73/148 - (49%) Gaps:24/148 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 PPKRK-RRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQK 399
            |.||| ||.||.||.||||:||..|::|||||:..||:||.:..|.|.||:|||.||||:||||.
Mouse   214 PLKRKQRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQA 278

  Fly   400 REEQ--------------ERLRKLQEEQCGSTTNGTTNSSSGTTSSTGNGSLTVKCPGSDHYSAQ 450
            ...|              ..:..|...|...|:...|:    ...:..:.|.||..|  ......
Mouse   279 GANQLMAFNHLIPGGFPPTAMPTLPTYQLSETSYQPTS----IPQAVSDPSSTVHRP--QPLPPS 337

  Fly   451 LVHIKSDPNGYSDADESS 468
            .||..:.|   |:||.||
Mouse   338 TVHQSTIP---SNADSSS 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeodomain 341..397 CDD:459649 34/55 (62%)
Pax3NP_001152992.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PAX 34..159 CDD:128645
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 37..93
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 113..161
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..228 9/13 (69%)
Homeodomain 220..276 CDD:459649 34/55 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..351 12/50 (24%)
Pax7 347..391 CDD:403540 4/6 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.