DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and vab-3

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001024570.1 Gene:vab-3 / 181251 WormBaseID:WBGene00006870 Length:455 Species:Caenorhabditis elegans


Alignment Length:155 Identity:57/155 - (36%)
Similarity:79/155 - (50%) Gaps:31/155 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 KRK-RRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKRE 401
            ||| :|:||.||:.|:|.||..|::||||||..||:||.|:.|.|.|::|||.|||||||   ||
 Worm   214 KRKLQRNRTSFTQVQIESLEKEFERTHYPDVFARERLAQKIQLPEARIQVWFSNRRAKWR---RE 275

  Fly   402 EQERLRKLQEEQCGSTTNGTTNSSSGT---------------------TSSTGNGSLTVKCPGSD 445
            |:.|.::.......|.:|||...:.|:                     ::::.|...|...|.:.
 Worm   276 EKMRNKRSSGTMDSSLSNGTPTPTPGSVTGSNMTNPIGSPASTPNRFPSNNSANLPTTNFVPQTS 340

  Fly   446 HYSAQLVHIKSDP------NGYSDA 464
            ...|.|.....||      ||:|.|
 Worm   341 QMYAGLSQPAMDPYSFGIANGFSMA 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 31/52 (60%)
vab-3NP_001024570.1 PAX 5..129 CDD:128645
COG5576 183..293 CDD:227863 42/81 (52%)
Homeobox 221..274 CDD:395001 33/55 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.