Sequence 1: | NP_001137762.2 | Gene: | Gsc / 33240 | FlyBaseID: | FBgn0010323 | Length: | 473 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_508669.1 | Gene: | lim-4 / 180672 | WormBaseID: | WBGene00002987 | Length: | 355 | Species: | Caenorhabditis elegans |
Alignment Length: | 118 | Identity: | 35/118 - (29%) |
---|---|---|---|
Similarity: | 50/118 - (42%) | Gaps: | 21/118 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 325 QHHLSHL----GHGPPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVE 385
Fly 386 VWFKNRRAKWRK--QKREEQERLRKLQEEQCGSTTNGTTNSSSGTTSSTGNGS 436 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gsc | NP_001137762.2 | Homeobox | 343..396 | CDD:278475 | 19/52 (37%) |
lim-4 | NP_508669.1 | LIM | 98..153 | CDD:278823 | |
LIM2_AWH | 168..222 | CDD:188765 | 1/1 (100%) | ||
HOX | 239..295 | CDD:197696 | 20/55 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R6207 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |