DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and lim-4

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_508669.1 Gene:lim-4 / 180672 WormBaseID:WBGene00002987 Length:355 Species:Caenorhabditis elegans


Alignment Length:118 Identity:35/118 - (29%)
Similarity:50/118 - (42%) Gaps:21/118 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 QHHLSHL----GHGPPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVE 385
            ||.|..:    |......:.:|.||.|.|:||..|:..|::...||....|::|....|.:...:
 Worm   220 QHFLELVEGDSGVSSQKAKTKRVRTTFAEDQLSVLQTYFNRDSNPDGADLEKIASMTGLSKRVTQ 284

  Fly   386 VWFKNRRAKWRK--QKREEQERLRKLQEEQCGSTTNGTTNSSSGTTSSTGNGS 436
            |||:|.||:.:|  ||.|..               ||.:..||...||....|
 Worm   285 VWFQNSRARQKKWHQKSEGD---------------NGDSQRSSVGPSSPSQKS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 19/52 (37%)
lim-4NP_508669.1 LIM 98..153 CDD:278823
LIM2_AWH 168..222 CDD:188765 1/1 (100%)
HOX 239..295 CDD:197696 20/55 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.