DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and Gsc

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_034481.1 Gene:Gsc / 14836 MGIID:95841 Length:256 Species:Mus musculus


Alignment Length:342 Identity:100/342 - (29%)
Similarity:128/342 - (37%) Gaps:122/342 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 ASLFTIDSILGSRQQGGGTAPSQGSHISSNGNQNGLTSNGISLGLKRSGAESPASPNSNSSSSAA 225
            ||:|:||:||.:|.                               :...|..|.:|       :|
Mouse     3 ASMFSIDNILAARP-------------------------------RCKDAVLPVAP-------SA 29

  Fly   226 ASPIRPQRVPAMLQHPGLHLGHLAAAAASGFAASPSDFLVAYPN------------------FYP 272
            |:|:         ..|.|| |.....|..|   :.||:...||.                  .|.
Mouse    30 AAPV---------VFPALH-GDSLYGAGGG---TSSDYGAFYPRPVAPGGAGLPAAVGSSRLGYN 81

  Fly   273 NYMHAAAVAHVAAAQMQAHVSGAA--------------AGLSGHGHHPHHPHGHPHHPHLGAHHH 323
            :|.:..  .||.||.:.....||.              .|..|.|.....|..|...|::.....
Mouse    82 SYFYGQ--LHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMNVGTL 144

  Fly   324 GQHHLSHLG--HGPPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEV 386
            .:..|..|.  |   .:||||||||||:||||.||..|.:|.||||..|||||.||.|:||:|||
Mouse   145 SRTELQLLNQLH---CRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEV 206

  Fly   387 WFKNRRAKWRKQKREEQERLRKLQEEQCGSTTNGTTNSSSGTTSSTGNGSLTVKCPGSDHYSAQL 451
            ||||||||||:|||...|      |.:.....|.|::.:|..                       
Mouse   207 WFKNRRAKWRRQKRSSSE------ESENAEKWNKTSSKASPE----------------------- 242

  Fly   452 VHIKSDPNGYSDADESS 468
               |.:..|.||.|..|
Mouse   243 ---KREEEGKSDLDSDS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 39/52 (75%)
GscNP_034481.1 Homeobox 163..216 CDD:278475 28/54 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..256 27/42 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7677
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm43288
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.