DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and dmbx1a

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_694509.1 Gene:dmbx1a / 142987 ZFINID:ZDB-GENE-020117-1 Length:388 Species:Danio rerio


Alignment Length:218 Identity:69/218 - (31%)
Similarity:108/218 - (49%) Gaps:49/218 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 GLSGHGHHPHHPHGHPHHPHLGAHHHGQH--------HLSHLG----------------HGPPPK 338
            |::|:..|..:.....::.|..|....||        |...|.                :|...:
Zfish     5 GVNGYSLHAMNSLSAMYNLHQQAAQQAQHAPDYRPSVHALTLAERLAGCTFQDIILEARYGSQHR 69

  Fly   339 RKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKRE-E 402
            ::||.||.||.:|||.||.||.||||||||:||:||:..:|.|.||:|||||||||:||::|. :
Zfish    70 KQRRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSLQ 134

  Fly   403 QERLRKLQE------------EQCGSTTNGTTNSSSGTTSSTGNGSLTVKCPGSDH-----YSAQ 450
            :|:|:|.::            ::..||.|......|.|:||:     :::...:.|     .|.:
Zfish   135 KEQLQKQKDVSTDGALAASDKDEAPSTLNLENQPPSSTSSSS-----SMEAEAAPHALGSELSVE 194

  Fly   451 LVHIKSDPNGYSDA--DESSDLE 471
            |....::.:|...|  |.::|.|
Zfish   195 LNVTSAEQSGSESATEDNATDKE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 36/52 (69%)
dmbx1aNP_694509.1 Homeobox 74..127 CDD:278475 36/52 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..272 19/94 (20%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 365..378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 1 1.000 - - X6207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.