DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and Dmbx1

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_017175446.1 Gene:Dmbx1 / 140477 MGIID:2153518 Length:389 Species:Mus musculus


Alignment Length:212 Identity:70/212 - (33%)
Similarity:104/212 - (49%) Gaps:48/212 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 QMQAHVSGAAAGLSGHGHHPHHPHGHPHHPHLGAHHHGQH--------HLSHLG----------- 332
            |::|..:....|::|:..|..:.....::.|..|....||        |...|.           
Mouse     2 QVKADAAMQHYGVNGYSLHAMNSLSAMYNLHQQAAQQAQHAPDYRPSVHALTLAERLAGCTFQDI 66

  Fly   333 -----HGPPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRR 392
                 :|...:::||.||.||.:|||.||.||.||||||||:||:||:..:|.|.||:|||||||
Mouse    67 ILEARYGSQHRKQRRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRR 131

  Fly   393 AKWRKQKRE-EQERLRKLQEEQCGSTTNGTTNSSSGTTSSTGNGSLTVKCPGSDHYSAQLVHIKS 456
            ||:||::|. ::|:|:|.:|.:                .|.|.|.  |:.|.||   .||.  ..
Mouse   132 AKFRKKQRSLQKEQLQKQKEAE----------------GSHGEGK--VEAPASD---TQLE--TE 173

  Fly   457 DPNGYSDADESSDLEVA 473
            .|.|....|..::|:::
Mouse   174 QPPGLPSGDPPAELQLS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 36/52 (69%)
Dmbx1XP_017175446.1 Homeobox 82..136 CDD:365835 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 1 1.000 - - X6207
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.