DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and esx1

DIOPT Version :10

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_031747349.1 Gene:esx1 / 116406733 XenbaseID:XB-GENE-29077183 Length:349 Species:Xenopus tropicalis


Alignment Length:69 Identity:42/69 - (60%)
Similarity:54/69 - (78%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 PPPKRK-RRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQ 398
            |..||| ||:||.|:..|||:||..|.|:|||||..||.||:::||.|.||:|||:||||||||:
 Frog   130 PSGKRKQRRYRTTFSNLQLEELEMAFRKSHYPDVFTREDLAMRLDLTEARVQVWFQNRRAKWRKR 194

  Fly   399 KREE 402
            ::.|
 Frog   195 EKTE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeodomain 341..397 CDD:459649 35/55 (64%)
esx1XP_031747349.1 Homeodomain 137..193 CDD:459649 35/55 (64%)
OAR 311..329 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.