DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and LDB3

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001165081.1 Gene:LDB3 / 11155 HGNCID:15710 Length:732 Species:Homo sapiens


Alignment Length:427 Identity:94/427 - (22%)
Similarity:138/427 - (32%) Gaps:151/427 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TTTTTPSTT--PDIPPSKAKFKITVVS--TPSPSP--------PPTP------------PPAGSM 55
            :||..|..|  |.||..|.....|..|  .|||||        |.||            |.|.|.
Human    90 STTAPPVQTPLPVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPSAFSS 154

  Fly    56 LAQMVETNSPPAGYTLKRSPSD----LGEQQQP----PRQISRSPGNTAAYHLTTAMLLNSQQCG 112
            ||:..:...|.|....|.||..    ||.:..|    |||.:...|           |.:::...
Human   155 LAEASDPGPPRASLRAKTSPEGARDLLGPKALPGSSQPRQYNNPIG-----------LYSAETLR 208

  Fly   113 YLGQRLQSVLQQQ--------HAQHQQSQSQTPSS-DDGSQSGVTILEEERRGGAAA-------- 160
            .:.|..|..|:.:        .|.:|:..:  ||: .|.:.|....:|.:..||.|.        
Human   209 EMAQMYQMSLRGKASGVGLPGGADYQERFN--PSALKDSALSTHKPIEVKGLGGKATIIHAQYNT 271

  Fly   161 -ASLFTIDSILGSRQQGGGTAPSQGSHISSN-------------------GNQN----------- 194
             .|:::.|:|:.:.   .|.|.:|||..|.:                   .:||           
Human   272 PISMYSQDAIMDAI---AGQAQAQGSDFSGSLPIKDLAVDSASPVYQAVIKSQNKPEDEADEWAR 333

  Fly   195 ---GLTSNGISLGLKRSGAE----------------------------SPASPNSNSSSSAAASP 228
               .|.|....:..:.:|.|                            :||:..|.|...||.:|
Human   334 RSSNLQSRSFRILAQMTGTEFMQDPDEEALRRSRPQASSYSPAVAASSAPATHTSYSEGPAAPAP 398

  Fly   229 ---------IRP---QRVPAMLQHPGLHLGH----LAAAAASGFAASPSDFLVAY-PNFYPNYMH 276
                     |||   |.|||....|.....:    ...:.|..:..||:.   || |:..|.|..
Human   399 KPRVVTTASIRPSVYQPVPASTYSPSPGANYSPTPYTPSPAPAYTPSPAP---AYTPSPVPTYTP 460

  Fly   277 AAAVAHVAAAQMQAHVSGAAAGLSGHGHHPHHPHGHP 313
            :.|.|:..:.....:.:.:.|...|    |..|...|
Human   461 SPAPAYTPSPAPNYNPAPSVAYSGG----PAEPASRP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475
LDB3NP_001165081.1 PDZ_signaling 5..81 CDD:238492
DUF4045 <77..180 CDD:330572 28/89 (31%)
ZM 189..214 CDD:128974 6/35 (17%)
DUF4749 263..353 CDD:318205 14/92 (15%)
Atrophin-1 <387..554 CDD:331285 28/114 (25%)
LIM1_ZASP_Cypher 556..607 CDD:188838
LIM2_Enigma_like 615..666 CDD:188748
LIM3_Enigma_like 674..727 CDD:188749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.