DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and rax2

DIOPT Version :10

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_002941436.1 Gene:rax2 / 100494721 XenbaseID:XB-GENE-494483 Length:227 Species:Xenopus tropicalis


Alignment Length:97 Identity:46/97 - (47%)
Similarity:63/97 - (64%) Gaps:1/97 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 PPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKR 400
            |.|:.||:||.||..||.:||..|:::|||||..||:||:||.|.|.||:|||:|||||||:|::
 Frog    32 PKKKHRRNRTTFTTYQLHELERAFERSHYPDVYSREELAMKVSLPEVRVQVWFQNRRAKWRRQEK 96

  Fly   401 EEQERLRKLQEEQCGSTTNGTTNSSSGTTSST 432
            .|... .||.:....|.:.....:..|..|:|
 Frog    97 LETSS-SKLHDSPLLSFSRSPMATGVGPLSNT 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeodomain 341..397 CDD:459649 35/55 (64%)
rax2XP_002941436.1 Homeodomain 37..93 CDD:459649 35/55 (64%)
OAR 200..216 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.