DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and hoxb8

DIOPT Version :9

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_002938067.1 Gene:hoxb8 / 100493882 XenbaseID:XB-GENE-990961 Length:243 Species:Xenopus tropicalis


Alignment Length:100 Identity:30/100 - (30%)
Similarity:49/100 - (49%) Gaps:9/100 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 KRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKRE--- 401
            :||.|..::..|..:||..|....|.....|.:::..:.|.|.:|::||:|||.||:|:..:   
 Frog   145 RRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKF 209

  Fly   402 -----EQERLRKLQEEQCGSTTNGTTNSSSGTTSS 431
                 |||.|.| |:.:.|..|....:...|..|:
 Frog   210 PSSKCEQEELEK-QKMERGQDTEEALDGQKGEKSN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeobox 343..396 CDD:278475 16/52 (31%)
hoxb8XP_002938067.1 Homeobox 149..202 CDD:365835 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.