DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and shox

DIOPT Version :10

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_004911874.1 Gene:shox / 100486480 XenbaseID:XB-GENE-920752 Length:334 Species:Xenopus tropicalis


Alignment Length:68 Identity:37/68 - (54%)
Similarity:50/68 - (73%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 GPPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQ 398
            |....::||.||.||.|||.:||..||:|||||..:||:|:.::.|.|.||:|||:|||||.|||
 Frog   150 GQTKLKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQ 214

  Fly   399 KRE 401
            :.:
 Frog   215 ENQ 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeodomain 341..397 CDD:459649 33/55 (60%)
shoxXP_004911874.1 Homeodomain 157..213 CDD:459649 33/55 (60%)
OAR 314..330 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.