DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gsc and shox2

DIOPT Version :10

Sequence 1:NP_001137762.2 Gene:Gsc / 33240 FlyBaseID:FBgn0010323 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001093694.1 Gene:shox2 / 100101703 XenbaseID:XB-GENE-480993 Length:311 Species:Xenopus tropicalis


Alignment Length:63 Identity:36/63 - (57%)
Similarity:49/63 - (77%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 RKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVEVWFKNRRAKWRKQKRE 401
            ::||.||.||.|||.:||..||:|||||..:||:|:.::.|.|.||:|||:|||||.|||:.:
 Frog   119 KQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQ 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GscNP_001137762.2 Homeodomain 341..397 CDD:459649 33/55 (60%)
shox2NP_001093694.1 Homeodomain 121..177 CDD:459649 33/55 (60%)
OAR 292..307 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.