DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and ISX

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001290437.1 Gene:ISX / 91464 HGNCID:28084 Length:245 Species:Homo sapiens


Alignment Length:86 Identity:50/86 - (58%)
Similarity:61/86 - (70%) Gaps:2/86 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKI 71
            ::.:||.||||.|.||.|||:.|..||||||..|.:||.||:|.|||||:||||:||||||||||
Human    79 RKSKRRVRTTFTTEQLHELEKIFHFTHYPDVHIRSQLAARINLPEARVQIWFQNQRAKWRKQEKI 143

  Fly    72 GGLGG--DYKEGALDLDVSYD 90
            |.||.  ...|.::.|..:.|
Human   144 GNLGAPQQLSEASVALPTNLD 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 38/55 (69%)
ISXNP_001290437.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..86 2/6 (33%)
Homeodomain 83..139 CDD:459649 38/55 (69%)

Return to query results.
Submit another query.