DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and PHOX2B

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_003915.2 Gene:PHOX2B / 8929 HGNCID:9143 Length:314 Species:Homo sapiens


Alignment Length:147 Identity:67/147 - (45%)
Similarity:81/147 - (55%) Gaps:27/147 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTM--KRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAK 64
            |.|.:  ||||||.||||.:.||:||||.|..|||||::.|||||::||||||||||||||||||
Human    88 DHGGLNEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAK 152

  Fly    65 WRKQEKI---------GGLGGDYKEGALDLDVSYDDSAVLGQLD-SALGGGGTLLPDTPPQSSNS 119
            :||||:.         .|..|...:.:.|     |:|......| .:.||.|.....||...:| 
Human   153 FRKQERAAAAAAAAAKNGSSGKKSDSSRD-----DESKEAKSTDPDSTGGPGPNPNPTPSCGAN- 211

  Fly   120 LDNELKASYGTGAMSPS 136
                     |.|...||
Human   212 ---------GGGGGGPS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 39/51 (76%)
PHOX2BNP_003915.2 Homeobox 102..155 CDD:395001 39/52 (75%)
polyalanine repeat 241..260
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.