DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and HAT14

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_196289.2 Gene:HAT14 / 830560 AraportID:AT5G06710 Length:336 Species:Arabidopsis thaliana


Alignment Length:71 Identity:21/71 - (29%)
Similarity:39/71 - (54%) Gaps:6/71 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            :.|:.::|.|..:.     |...||.:|:.....:...:..||.:::|...:|:||||||||:.:
plant   184 ENGSTRKKLRLSKD-----QSAFLEDSFKEHSTLNPKQKIALAKQLNLRPRQVEVWFQNRRARTK 243

  Fly    67 -KQEKI 71
             ||.::
plant   244 LKQTEV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 17/56 (30%)
HAT14NP_196289.2 HOX 187..243 CDD:197696 18/60 (30%)
HALZ 245..288 CDD:128634 2/5 (40%)

Return to query results.
Submit another query.