DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and HAT22

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_195493.1 Gene:HAT22 / 829935 AraportID:AT4G37790 Length:278 Species:Arabidopsis thaliana


Alignment Length:71 Identity:22/71 - (30%)
Similarity:39/71 - (54%) Gaps:5/71 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            ::|...||:.|.....:.|    ||..|:.....:...::.||.:::|...:|:||||||||:.:
plant   119 EEGVSARKKLRLTKQQSAL----LEDNFKLHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTK 179

  Fly    67 -KQEKI 71
             ||.::
plant   180 LKQTEV 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 17/56 (30%)
HAT22NP_195493.1 Homeodomain 125..179 CDD:459649 19/57 (33%)
HALZ 181..224 CDD:128634 2/5 (40%)

Return to query results.
Submit another query.