DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and HB-2

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_193411.1 Gene:HB-2 / 827384 AraportID:AT4G16780 Length:284 Species:Arabidopsis thaliana


Alignment Length:210 Identity:41/210 - (19%)
Similarity:72/210 - (34%) Gaps:77/210 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            :.|...||:.|.....:.:    ||..|:.....:...::.||.::.|...:|:||||||||:.:
plant   122 EDGDNSRKKLRLSKDQSAI----LEETFKDHSTLNPKQKQALAKQLGLRARQVEVWFQNRRARTK 182

  Fly    67 -KQEKIGGLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLPDTPPQSSNSLDNELKASYGT 130
             ||.::                   |...|.:....|           .:.:..|..|:.     
plant   183 LKQTEV-------------------DCEFLRRCCENL-----------TEENRRLQKEVT----- 212

  Fly   131 GAMSPSRLSPNIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQAQTHPQMDSDNQLQQHPPQQHAS 195
             .:...:|||..:::::                    ||.|             |...|..:|.|
plant   213 -ELRALKLSPQFYMHMS--------------------PPTT-------------LTMCPSCEHVS 243

  Fly   196 DP---IHAGSSSHHQ 207
            .|   ..|.:|:||:
plant   244 VPPPQPQAATSAHHR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 16/56 (29%)
HB-2NP_193411.1 HD-ZIP_N 8..107 CDD:461370
HOX 128..182 CDD:197696 18/57 (32%)
HALZ 184..227 CDD:128634 10/78 (13%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.