| Sequence 1: | NP_477330.1 | Gene: | Pph13 / 33239 | FlyBaseID: | FBgn0023489 | Length: | 357 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_182018.1 | Gene: | HB4 / 819100 | AraportID: | AT2G44910 | Length: | 318 | Species: | Arabidopsis thaliana |
| Alignment Length: | 30 | Identity: | 14/30 - (46%) |
|---|---|---|---|
| Similarity: | 23/30 - (76%) | Gaps: | 1/30 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 43 LAVRIDLTEARVQVWFQNRRAKWR-KQEKI 71 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Pph13 | NP_477330.1 | Homeodomain | 11..67 | CDD:459649 | 12/24 (50%) |
| HB4 | NP_182018.1 | HD-ZIP_N | 8..124 | CDD:461370 | |
| Homeodomain | 162..216 | CDD:459649 | 12/22 (55%) | ||
| HALZ | 218..261 | CDD:128634 | 2/5 (40%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||