DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and HB4

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_182018.1 Gene:HB4 / 819100 AraportID:AT2G44910 Length:318 Species:Arabidopsis thaliana


Alignment Length:30 Identity:14/30 - (46%)
Similarity:23/30 - (76%) Gaps:1/30 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LAVRIDLTEARVQVWFQNRRAKWR-KQEKI 71
            ||.:::|...:|:||||||||:.: ||.::
plant   193 LAKQLNLRARQVEVWFQNRRARTKLKQTEV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 12/24 (50%)
HB4NP_182018.1 HD-ZIP_N 8..124 CDD:461370
Homeodomain 162..216 CDD:459649 12/22 (55%)
HALZ 218..261 CDD:128634 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.