DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and HAT9

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_179865.1 Gene:HAT9 / 816811 AraportID:AT2G22800 Length:274 Species:Arabidopsis thaliana


Alignment Length:71 Identity:22/71 - (30%)
Similarity:40/71 - (56%) Gaps:5/71 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            ::|...||:.|.....:.|    ||.:|:.....:...::.||.:::|...:|:||||||||:.:
plant   106 EEGISARKKLRLTKQQSAL----LEESFKDHSTLNPKQKQVLARQLNLRPRQVEVWFQNRRARTK 166

  Fly    67 -KQEKI 71
             ||.::
plant   167 LKQTEV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 17/56 (30%)
HAT9NP_179865.1 HOX 112..166 CDD:197696 19/57 (33%)
HALZ 168..211 CDD:128634 2/5 (40%)

Return to query results.
Submit another query.