DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and ALX1

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_008913.2 Gene:ALX1 / 8092 HGNCID:1494 Length:326 Species:Homo sapiens


Alignment Length:209 Identity:74/209 - (35%)
Similarity:101/209 - (48%) Gaps:43/209 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            |......|:||:||||.:|||:|||:.||:||||||:.||:||:|.:||||||||||||||||||
Human   124 DSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWR 188

  Fly    67 KQEKIGGLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGGTLLP--DTPPQSSNSL--DNELKAS 127
            |:|:.|.:.......|...|:|                   :||  |:.||..|:|  .|....|
Human   189 KRERYGQIQQAKSHFAATYDIS-------------------VLPRTDSYPQIQNNLWAGNASGGS 234

  Fly   128 YGTGAMSPSRLSPNIFLNLNIDHLGLERGGSGLSMEWSTYPPQTQAQTHPQMDSDNQLQQHPPQQ 192
            ..|..|.|                   |..|.....:| :.|:|.:......:..||....|...
Human   235 VVTSCMLP-------------------RDTSSCMTPYS-HSPRTDSSYTGFSNHQNQFSHVPLNN 279

  Fly   193 HASDPIHAGSSSHH 206
            ..:|.:..|:::.|
Human   280 FFTDSLLTGATNGH 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 39/51 (76%)
ALX1NP_008913.2 Homeobox 135..189 CDD:365835 40/53 (75%)
Transactivation domain. /evidence=ECO:0000250|UniProtKB:Q63087 192..326 27/141 (19%)
OAR 302..320 CDD:367680
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41860
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5874
SonicParanoid 1 1.000 - - X469
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.