powered by:
Protein Alignment Pph13 and Rhox13
DIOPT Version :9
Sequence 1: | NP_477330.1 |
Gene: | Pph13 / 33239 |
FlyBaseID: | FBgn0023489 |
Length: | 357 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001171931.1 |
Gene: | Rhox13 / 73614 |
MGIID: | 1920864 |
Length: | 232 |
Species: | Mus musculus |
Alignment Length: | 65 |
Identity: | 28/65 - (43%) |
Similarity: | 43/65 - (66%) |
Gaps: | 0/65 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 MKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEK 70
::|::|.....|...|::|:|..|:.|.|||:..|.|||..:::.|.:|:|||.|||||.||.|:
Mouse 144 VRRRRRGPPFHFAQWQVEEMESLFEETQYPDLLTRGELARTLNVPEVKVKVWFTNRRAKQRKIER 208
Fly 71 70
Mouse 209 208
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000011 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.