DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Rhox4g

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001034787.1 Gene:Rhox4g / 664608 MGIID:3613394 Length:205 Species:Mus musculus


Alignment Length:74 Identity:29/74 - (39%)
Similarity:40/74 - (54%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIGG 73
            :||.....|...|||||||.||:.|:.....|..||..|.::||||..||:.||..:|:.:...|
Mouse   127 QQRSLHYNFQWWQLQELERIFQQNHFIRAEERRHLARWIGVSEARVMTWFKKRREHFRRGQSQLG 191

  Fly    74 LGGDYKEGA 82
            :..|...|:
Mouse   192 MNDDAPVGS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 24/55 (44%)
Rhox4gNP_001034787.1 homeodomain 129..187 CDD:238039 25/57 (44%)

Return to query results.
Submit another query.