DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Rhox4f

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001034785.1 Gene:Rhox4f / 636177 MGIID:3613392 Length:205 Species:Mus musculus


Alignment Length:102 Identity:21/102 - (20%)
Similarity:31/102 - (30%) Gaps:39/102 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KDFDGNY-------IYARYDEFAIGSED--EQY---------------------PLMKLGS---- 58
            |.:|.||       :.||..:.||...|  ||.                     |..|.||    
Mouse   113 KFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSR 177

  Fly    59 -----YTGTAGDALNYHKDMKFSTVDRDNDVSTTHCA 90
                 ...::|.|....||::...:..:..|.:...|
Mouse   178 PSSAKRASSSGSASRSDKDLETQVIQLNEQVHSLKLA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 16/77 (21%)
Rhox4fNP_001034785.1 homeodomain 129..187 CDD:238039 11/57 (19%)

Return to query results.
Submit another query.