DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and ALX4

DIOPT Version :9

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_068745.2 Gene:ALX4 / 60529 HGNCID:450 Length:411 Species:Homo sapiens


Alignment Length:185 Identity:67/185 - (36%)
Similarity:92/185 - (49%) Gaps:41/185 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            |..:.|.|:||.||||.:.||:|||:.||:||||||:.||:||:|.|||||||||||||||||||
Human   206 DSESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWR 270

  Fly    67 KQEKIGGLGGDYKEGALDLDVSYD-------DSAVLGQLDSALGGGGTLLP-------------- 110
            |:|:.|.:    ::.......:|:       ::....|..|.||..|...|              
Human   271 KRERFGQM----QQVRTHFSTAYELPLLTRAENYAQIQNPSWLGNNGAASPVPACVVPCDPVPAC 331

  Fly   111 ----DTPPQSSNSLDNELKASYGTGAMSPSRLSPNIFLNLNIDHLGLERGGSGLS 161
                ..||.|..|...:..:..|.|:            ::...|:|...|.:.||
Human   332 MSPHAHPPGSGASSVTDFLSVSGAGS------------HVGQTHMGSLFGAASLS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 39/51 (76%)
ALX4NP_068745.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..145
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..219 5/12 (42%)
Homeobox 218..270 CDD:278475 39/51 (76%)
OAR 387..404 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 391..404
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41860
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X469
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.