DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and drgx

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001032182.1 Gene:drgx / 560399 ZFINID:ZDB-GENE-070330-1 Length:287 Species:Danio rerio


Alignment Length:132 Identity:60/132 - (45%)
Similarity:77/132 - (58%) Gaps:23/132 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            |.|.::|||||.||||...||:.||..|.:|||||||.|||||::|:||||||||||||||||||
Zfish    34 DDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFAREELAMKINLTEARVQVWFQNRRAKWR 98

  Fly    67 KQEKIGGLGGDYKEG-----------ALDLDVSYDDSA--------VLGQLDSALGGGGTLLPDT 112
            |.|:    |...::|           |.:|:.|..|.:        :...::..:|.||...|..
Zfish    99 KTER----GTSEQDGGKEQMNEGNPPARNLNQSPVDHSRSKKEPMELQQNINRVVGSGGPFFPSC 159

  Fly   113 PP 114
            .|
Zfish   160 LP 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 41/55 (75%)
drgxNP_001032182.1 Homeodomain 43..99 CDD:459649 41/55 (75%)
OAR 207..224 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.