DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Dbx2

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001418946.1 Gene:Dbx2 / 541457 RGDID:1359605 Length:377 Species:Rattus norvegicus


Alignment Length:69 Identity:25/69 - (36%)
Similarity:40/69 - (57%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66
            |..:..|:....|..|:..|.:.||:.||:..|.....|.:||:.:.|.|::|::||||||.|||
  Rat   218 DSNSKARRGILRRAVFSEDQRKALEKMFQKQKYISKTDRRKLAISLGLKESQVKIWFQNRRMKWR 282

  Fly    67 KQEK 70
            ..::
  Rat   283 NSKE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 22/55 (40%)
Dbx2NP_001418946.1 PHA03247 <39..186 CDD:223021
Homeodomain 229..283 CDD:459649 22/53 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.