DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pph13 and Hoxb5

DIOPT Version :10

Sequence 1:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001178854.1 Gene:Hoxb5 / 497987 RGDID:1562292 Length:269 Species:Rattus norvegicus


Alignment Length:61 Identity:24/61 - (39%)
Similarity:36/61 - (59%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKI 71
            :|.||.:...|..|||:.|....|.....|.|:|..:.|:|.::::||||||.||:|..|:
  Rat   195 KRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 22/55 (40%)
Hoxb5NP_001178854.1 PRK07003 <67..>171 CDD:235906
Homeodomain 195..251 CDD:459649 22/55 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.